Auto update filter

This commit is contained in:
TeamCity 2017-05-24 12:03:23 +03:00
parent e3b8252af5
commit ca1ac28e14
1 changed files with 17 additions and 2 deletions

View File

@ -2,7 +2,7 @@
! Title: Simplified domain names filter
! Homepage: https://github.com/AdguardTeam/AdguardDNS
! License: https://github.com/AdguardTeam/AdguardDNS/blob/master/LICENSE
! Last modified: 2017-05-23 12:03:16
! Last modified: 2017-05-24 12:03:19
! Decsription: Filter composed from several other filters (English filter, Social media filter, Spyware filter, Mobile ads filter, EasyList and EasyPrivacy) and simplified specifically to be better compatible with DNS-level ad blocking.
!
! Adservice
@ -1868,6 +1868,7 @@
||goodadvert.ru^
||goodadvertising.info^
||goodluckblockingthis.com^
||goodtag.it^
||googleadservicepixel.com^
||googlesyndicatiion.com^
||gorgonkil.com^
@ -3124,6 +3125,7 @@
||recomendedsite.com^
||redcourtside.com^
||redintelligence.net^
||redirectnative.com^
||redirectpopads.com^
||rediskina.com^
||redpeepers.com^
@ -4553,6 +4555,7 @@
||ccwinenmbnso.com^
||cdbkxcnfmehf.com^
||cdbxuzzlgfhh.com^
||cdhzxcwuibzk.com^
||cdicyazp.com^
||cdqmeyhqrwinofutpcepbahedusocxqyfokvehqlqpusttfwve.com^
||cdrjblrhsuxljwesjholugzxwukkerpobmonocjygnautvzjjm.com^
@ -4700,6 +4703,7 @@
||ecmeqhxevxgmtoxubrjstrrlyfgrrtqhvafyagettmwnwkwltn.com^
||ectbduztanog.com^
||edgsscofljhc.com^
||ednnpxhjsqyd.com^
||edvbyybaviln.com^
||edwywpsufuda.com^
||eefbzuwvnnab.com^
@ -4776,6 +4780,7 @@
||fgkvpyrmkbap.com^
||fgmucsiirrsq.com^
||fgwsjwiaqtjc.com^
||fgzaxilcgxum.com^
||fhawywadfjlo.com^
||fhylnqzxwsbo.com^
||firugsivsqot.com^
@ -4999,6 +5004,7 @@
||iknctklddhoh.com^
||ikvltjooosqh.com^
||ilsivrexvpyv.com^
||ilvibsabwuza.com^
||imbbjywwahev.com^
||imgoatxhxior.com^
||imqkdsdgfygm.com^
@ -5164,6 +5170,7 @@
||kqsipdhvcejx.com^
||krmuxxubtkrg.com^
||krovrhmqgupd.com^
||krsdoqvsmgld.com^
||krxexwfnghfu.com^
||krxpudrzyvko.com^
||krziyrrnvjai.com^
@ -5989,6 +5996,7 @@
||vtcquvxsaosz.com^
||vtoygnkflehv.com^
||vtqdavdjsymt.com^
||vtqmlzprsunm.com^
||vucanmoywief.com^
||vulexmouotod.com^
||vunwzlxfsogj.com^
@ -6623,6 +6631,9 @@
!
! Содержит доменные имена, использующиеся рекламными сетями.
!
||nehuha.ru^
||pabrashu.info^
||anobufefig.com^
||clicktoclick.ru^
||mrelko.com^
||wom8day.ru^
@ -9842,6 +9853,7 @@ thr.ru##.top_branding
!
! Section contains the list of advertising networks, which are hosted on non advertising sites as subdomains
!
://*.1sexxx.com
||stepan-fe.go.mail.ru^
://*.2img-pic.ru^
||an.yandex.ru^
@ -9928,6 +9940,7 @@ ws*://video.docfilms.info^
!
! Section contains list of advertising networks
!
||ssl4me.cf^
||putrr3.com^
||sexpennyauctions.com^
||78.140.130.88^
@ -10314,6 +10327,7 @@ ws*://video.docfilms.info^
!
! Section contains the list of advertising networks, which are hosted on non advertising sites as subdomains
!
||a75-10-so.ssl.cdn13.com^
||dmtw0i4zln92b.cloudfront.net^
||d160mt023h8h3d.cloudfront.net^
||d28k9nkt2spnp.cloudfront.net^
@ -13988,6 +14002,7 @@ ws*://video.docfilms.info^
!
! Section contains the list of tracking servers, which are hosted on useful sites as subdomains
!
||ca.video-cdn.net^
||events.ocdn.eu^
||cmp-cdn.ghostery.com^
||services.wetek.com^
@ -14229,6 +14244,7 @@ ws*://video.docfilms.info^
!
! Section contains rules for mobile analytics and spyware
!
||report.appmetrica.yandex.net^
||api.oneaudience.com^
||api.gameofwhales.com^
||d.applvn.com^
@ -14376,7 +14392,6 @@ ws*://video.docfilms.info^
||quantcount.com^
||r.browser.miui.com^
||rc.dxsvr.com^
||report.appmetrica.yandex.net^
||rlog-api.under9.co^
||rlog.9gag.com^
||sc-analytics.appspot.com^